PDB entry 4na0

View 4na0 on RCSB PDB site
Description: Crystal structure of mouse poly(ADP-ribose) glycohydrolase (PARG) catalytic domain with ADPRibose
Class: hydrolase
Keywords: Poly(ADP-ribose) glycohydrolase, hydrolase
Deposited on 2013-10-21, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.3
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4na0a_
  • Chain 'B':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4na0b_
  • Chain 'C':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4na0c_
  • Heterogens: IOD, AR6

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4na0A (A:)
    gnlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykd
    lwdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvay
    skkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvt
    msqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfr
    rvtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvg
    ggvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwars
    hedgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsa
    vatgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkld
    vgkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4na0A (A:)
    kkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdnkh
    vkmpcseqnlyagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdfwdkv
    leeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllanaffc
    tfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvtftrq
    sledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqeeirfl
    inpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqrrcte
    ivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafggdar
    lkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryyneec
    rncpgpdiklypfiyhavess
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4na0B (B:)
    gnlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykd
    lwdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvay
    skkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvt
    msqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfr
    rvtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvg
    ggvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwars
    hedgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsa
    vatgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkld
    vgkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4na0B (B:)
    kkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdnkh
    vkmpcseqnlytagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdfwdk
    vleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllanaff
    ctfprrnakmseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvtftrq
    sledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqeeirfl
    inpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqrrcte
    ivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafggdar
    lkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryyneec
    rncstpgpdiklypfiyhaves
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4na0C (C:)
    gnlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykd
    lwdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvay
    skkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvt
    msqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfr
    rvtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvg
    ggvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwars
    hedgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsa
    vatgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkld
    vgkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4na0C (C:)
    kkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdnkh
    vkmpcseqnlytagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdfwdk
    vleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllanaff
    ctfprrnakseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvtftrqs
    ledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqeeirfli
    npelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqrrctei
    vaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafggdarl
    kaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryyneecr
    ncstgpdiklypfiyhavess