PDB entry 4n9z

View 4n9z on RCSB PDB site
Description: Crystal structure of mouse poly(ADP-ribose) glycohydrolase (PARG) catalytic domain mutant E749Q
Class: hydrolase
Keywords: Poly(ADP-ribose) glycohydrolase, PARG, hydrolase
Deposited on 2013-10-21, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88622
      • engineered mutation (311)
    Domains in SCOPe 2.07: d4n9za_
  • Chain 'B':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88622
      • engineered mutation (311)
    Domains in SCOPe 2.07: d4n9zb_
  • Heterogens: V3L, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n9zA (A:)
    gnlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykd
    lwdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvay
    skkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvt
    msqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfr
    rvtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvg
    ggvtgaglvqeqirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwars
    hedgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsa
    vatgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkld
    vgkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n9zA (A:)
    pekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdn
    khvkmpcseqnlypvtagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvd
    fwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiaslla
    naffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglv
    tftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqe
    qirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwq
    rrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgaf
    ggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllry
    yneecrncstpgpdiklypfiyhavessa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n9zB (B:)
    gnlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykd
    lwdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvay
    skkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvt
    msqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfr
    rvtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvg
    ggvtgaglvqeqirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwars
    hedgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsa
    vatgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkld
    vgkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n9zB (B:)
    pekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdn
    khvkmpcseqnlyptagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdf
    wdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllan
    affctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvt
    ftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqeq
    irflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqr
    rcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafg
    gdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryy
    neecrncstpgpdiklypfiyhavessa