PDB entry 4n9o

View 4n9o on RCSB PDB site
Description: Probing the N-terminal beta-sheet conversion in the crystal structure of the human prion protein bound to a Nanobody
Class: membrane protein/protein binding
Keywords: Prion-like fold, antibody, nanobody, MEMBRANE PROTEIN-PROTEIN BINDING complex
Deposited on 2013-10-21, released 2014-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.151
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRNP, PRIP, PRP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nanobody Nb484
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4N9O (0-End)
    Domains in SCOPe 2.08: d4n9ob1, d4n9ob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4n9oB (B:)
aaqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
tvsshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4n9oB (B:)
aaqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
tvss