PDB entry 4n83

View 4n83 on RCSB PDB site
Description: X-ray crystal structure of Streptococcus sanguinis dimanganese(II)-NrdF
Class: oxidoreductase
Keywords: oxidation-reduction, flavin mononucleotide, manganese, oxidoreductase
Deposited on 2013-10-16, released 2014-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83a_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83b_
  • Chain 'C':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83c_
  • Chain 'D':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83d_
  • Chain 'E':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83e_
  • Chain 'F':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83f_
  • Chain 'G':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83g_
  • Chain 'H':
    Compound: Ribonucleoside-diphosphate reductase subunit beta
    Species: Streptococcus sanguinis [TaxId:388919]
    Gene: nrdF, SSA_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n83h_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n83A (A:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83A (A:)
    tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
    tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
    wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
    iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
    vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngist
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n83B (B:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83B (B:)
    tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
    tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
    wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
    iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
    vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n83C (C:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83C (C:)
    tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
    tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
    wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
    iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
    vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngis
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n83D (D:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83D (D:)
    tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
    tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
    wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
    iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
    vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngis
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4n83E (E:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83E (E:)
    tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
    tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
    wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
    iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
    vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngis
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4n83F (F:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83F (F:)
    tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
    tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
    wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
    iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
    vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngis
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4n83G (G:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83G (G:)
    yykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfgglt
    lldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifaw
    tntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvaei
    ikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydtv
    gwteevktflrynankalmnlgqdplfpdsaddvnpivmngis
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4n83H (H:)
    mqtyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfg
    gltlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseidei
    fawtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanv
    aeiikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegytesly
    dtvgwteevktflrynankalmnlgqdplfpdsaddvnpivmngistgtsnhdffsqvgn
    gyllgeveamqdddynygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n83H (H:)
    yykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfgglt
    lldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifaw
    tntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvaei
    ikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydtv
    gwteevktflrynankalmnlgqdplfpdsaddvnpivmngis