PDB entry 4n7i

View 4n7i on RCSB PDB site
Description: Crystal Structure of Intracellular B30.2 Domain of BTN3A1
Class: Signaling Protein
Keywords: Butyrophilin, CD277, B30.2, PTY/SPRY, Signaling Protein
Deposited on 2013-10-15, released 2014-04-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.137
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTF5, BTN3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00481 (2-187)
      • expression tag (1)
      • conflict (24)
      • conflict (37)
    Domains in SCOPe 2.06: d4n7ia1, d4n7ia2
  • Heterogens: GOL, BME, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n7iA (A:)
    mgaynewkkalfkpadvildpktadpillvsedqrsverakepqdlpdnperfnwhycvl
    gcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlt
    eprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlep
    talticpale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n7iA (A:)
    gaynewkkalfkpadvildpktadpillvsedqrsverakepqdlpdnperfnwhycvlg
    cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte
    prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
    alticpa