PDB entry 4n7f
View 4n7f on RCSB PDB site
Description: Crystal structure of 3rd WW domain of human Nedd4-1
Class: protein binding
Keywords: beta sheet, WW domain, target binding, proline rich region, cytosolic, PROTEIN BINDING
Deposited on
2013-10-15, released
2014-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2014-10-08, with a file datestamp of
2014-10-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.182
AEROSPACI score: 0.81
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: E3 ubiquitin-protein ligase NEDD4
Species: Homo sapiens [TaxId:9606]
Gene: KIAA0093, NEDD4, NEDD4-1, PIG53
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4n7fa1, d4n7fa2 - Chain 'B':
Compound: E3 ubiquitin-protein ligase NEDD4
Species: Homo sapiens [TaxId:9606]
Gene: KIAA0093, NEDD4, NEDD4-1, PIG53
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4n7fb1, d4n7fb2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4n7fA (A:)
amgsflpkgwevrhapngrpffidhntktttwedprlk
Sequence, based on observed residues (ATOM records): (download)
>4n7fA (A:)
amgsflpkgwevrhapngrpffidhntktttwedprl
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4n7fB (B:)
amgsflpkgwevrhapngrpffidhntktttwedprlk
Sequence, based on observed residues (ATOM records): (download)
>4n7fB (B:)
amgsflpkgwevrhapngrpffidhntktttwedprl