PDB entry 4n6z

View 4n6z on RCSB PDB site
Description: Pim1 Complexed with a pyridylcarboxamide
Class: transferase/transferase inhibitor
Keywords: kinase, phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-10-14, released 2013-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.161
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4n6za_
  • Heterogens: 2HW, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n6zA (A:)
    mahhhhhhlevlfqgpllskinslahlraapcndlhatklapgkekeplesqyqvgpllg
    sggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkvssgfsgvir
    lldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchncgvlh
    rdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsaav
    wslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfeeiq
    nhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6zA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh