PDB entry 4n6x

View 4n6x on RCSB PDB site
Description: Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain of NHERF1
Class: signaling protein
Keywords: CXCR2, NHERF1, Neutrophil, inflammatory diseases, SIGNALING PROTEIN
Deposited on 2013-10-14, released 2014-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.148
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF1/Chemokine Receptor CXCR2 fusion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NHERF, NHERF1, SLC9A3R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14745 (2-85)
      • expression tag (0-1)
      • see remark 999 (86-90)
    Domains in SCOPe 2.08: d4n6xa1, d4n6xa2, d4n6xa3
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4n6xA (A:)
    gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
    kethqqvvsriraalnavrllvvdpetsttl