PDB entry 4n6o

View 4n6o on RCSB PDB site
Description: Crystal structure of reduced legumain in complex with cystatin E/M
Class: hydrolase/hydrolase inhibitor
Keywords: complex, cysteine protease, inhibitor, legumain, asparaginyl endopeptidase, reactive center loop, papain, cathepsin, cancer, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-10-14, released 2015-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: legumain
    Species: Homo sapiens [TaxId:9606]
    Gene: LGMN, PRSC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99538 (0-End)
      • engineered mutation (237)
  • Chain 'B':
    Compound: cystatin-M
    Species: Homo sapiens [TaxId:9606]
    Gene: CST6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15828 (Start-122)
      • expression tag (123)
    Domains in SCOPe 2.08: d4n6ob1, d4n6ob2
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n6oB (B:)
    mdrpqermvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagik
    yfltmemgstdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhnc
    vqmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6oB (B:)
    gelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemgs
    tdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqml