PDB entry 4n6b

View 4n6b on RCSB PDB site
Description: Soybean Serine Acetyltransferase Complexed with CoA
Class: transferase
Keywords: acetyltransferase, TRANSFERASE
Deposited on 2013-10-11, released 2013-11-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.04: d4n6ba_
  • Chain 'B':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (15-16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.04: d4n6bb_
  • Chain 'C':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (15-16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.04: d4n6bc_
  • Chain 'D':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.04: d4n6bd_
  • Chain 'E':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.04: d4n6be_
  • Chain 'F':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.04: d4n6bf_
  • Heterogens: COA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n6bA (A:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6bA (A:)
    egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
    lflnafssdpslrsaavadlraarerdvsyshcllnykgflacqahrvahllwrqsrrpl
    alalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggtggd
    rhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n6bB (B:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6bB (B:)
    eegwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstlly
    dlflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllwrqs
    rrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlgg
    tgdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n6bC (C:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6bC (C:)
    deegwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstll
    ydlflnafssdpslrsaavadlraarerdpasyshcllnykgflacqahrvahllwrqsr
    rplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggt
    rhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n6bD (D:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6bD (D:)
    egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
    lflnafssdpslrsaavadlraarerdvsyshcllnykgflacqahrvahllwrqsrrpl
    alalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggtgdr
    hpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4n6bE (E:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6bE (E:)
    egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
    lflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllwrqsr
    rplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggt
    vggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4n6bF (F:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n6bF (F:)
    egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
    lflnafssdpslrsaavadlraarerdsyshcllnykgflacqahrvahllwrqsrrpla
    lalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggtggdr
    hpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv