PDB entry 4n69

View 4n69 on RCSB PDB site
Description: Soybean Serine Acetyltransferase Complexed with Serine
Class: transferase
Keywords: acetyltransferase, transferase
Deposited on 2013-10-11, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (15-16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.07: d4n69a_
  • Chain 'B':
    Compound: Serine Acetyltransferase Apoenzyme
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1KHY6
      • see remark 999 (15-16)
      • see remark 999 (19)
      • see remark 999 (21)
      • see remark 999 (33)
      • see remark 999 (52)
      • see remark 999 (83)
      • see remark 999 (88)
      • see remark 999 (136)
      • see remark 999 (148)
      • see remark 999 (243)
    Domains in SCOPe 2.07: d4n69b_
  • Heterogens: SER, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n69A (A:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n69A (A:)
    apdeegwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllst
    llydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllw
    rqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvt
    lggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnpa
    rlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n69B (B:)
    mptglpaanslvapdeegwvwgqikaearrdaesepalasylystilshsslerslsfhl
    gnklcsstllstllydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgfl
    acqahrvahllwrqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetav
    ignnvsilhhvtlggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlid
    vpprttavgnparlvggkekpskhedvpgesmdhtsfisewsdyii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n69B (B:)
    apdeegwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllst
    llydlflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllw
    rqsrrplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvt
    lggtgkvggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnpa
    rlv