PDB entry 4n64

View 4n64 on RCSB PDB site
Description: Crystal structure of hemagglutinin from an H7N9 influenza virus in complex with a biantennary glycan receptor
Class: viral protein
Keywords: viral envelope protein, hemagglutinin, viral fusion protein, viral protein
Deposited on 2013-10-11, released 2013-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:1332244]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n64a_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:1332244]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n64b_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:1332244]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n64c_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:1332244]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n64d_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n64A (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n64A (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n64B (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvsgrl
    vpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n64B (B:)
    gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
    elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
    rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n64C (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n64C (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n64D (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvsgrl
    vpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n64D (D:)
    gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
    elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
    rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq