PDB entry 4n5z

View 4n5z on RCSB PDB site
Description: Crystal structure of aerosol transmissible influenza H5 hemagglutinin mutant (N158D, N224K, Q226L and T318I) from the influenza virus A/Viet Nam/1203/2004 (H5N1)
Class: Viral protein
Keywords: H5N1, Influenza Virus, hemagglutinin, Viral Protein, Ferret transmissible
Deposited on 2013-10-10, released 2013-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.235
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5za_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5ze_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zf_
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zh_
  • Chain 'I':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zi_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zj_
  • Chain 'K':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zl_
  • Chain 'M':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zm_
  • Chain 'N':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zn_
  • Chain 'O':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zo_
  • Chain 'P':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zp_
  • Chain 'Q':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zq_
  • Chain 'R':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zr_
  • Chain 'S':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zs_
  • Chain 'T':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zt_
  • Chain 'U':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zu_
  • Chain 'V':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zv_
  • Chain 'W':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zw_
  • Chain 'X':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zx_
  • Chain 'Y':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
    Domains in SCOPe 2.05: d4n5zy_
  • Chain 'Z':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.05: d4n5zz_
  • Chain 'a':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
  • Chain 'b':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
  • Chain 'c':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
      • engineered mutation (318)
  • Chain 'd':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n5zA (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zA (A:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n5zB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n5zC (C:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zC (C:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n5zD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4n5zE (E:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zE (E:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4n5zF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4n5zG (G:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zG (G:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4n5zH (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zH (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4n5zI (I:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zI (I:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4n5zJ (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zJ (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4n5zK (K:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zK (K:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4n5zL (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zL (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4n5zM (M:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zM (M:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4n5zN (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zN (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4n5zO (O:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zO (O:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4n5zP (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zP (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4n5zQ (Q:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zQ (Q:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4n5zR (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zR (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4n5zS (S:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zS (S:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4n5zT (T:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zT (T:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4n5zU (U:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zU (U:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4n5zV (V:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zV (V:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4n5zW (W:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zW (W:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4n5zX (X:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zX (X:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4n5zY (Y:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlaiglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zY (Y:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlaiglrnsp
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4n5zZ (Z:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5zZ (Z:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.