PDB entry 4n5f

View 4n5f on RCSB PDB site
Description: Crystal Structure of a Putative acyl-CoA dehydrogenase with bound FADH2 from Burkholderia cenocepacia J2315
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, acyl-CoA dehydrogenase, OXIDOREDUCTASE
Deposited on 2013-10-09, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acyl-CoA dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: BCAM2196, BceJ2315_56330
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EGC8 (8-384)
      • expression tag (7)
    Domains in SCOPe 2.07: d4n5fa1, d4n5fa2, d4n5fa3
  • Chain 'B':
    Compound: putative acyl-CoA dehydrogenase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: BCAM2196, BceJ2315_56330
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EGC8 (8-384)
      • expression tag (7)
    Domains in SCOPe 2.07: d4n5fb1, d4n5fb2, d4n5fb3
  • Heterogens: FDA, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n5fA (A:)
    mahhhhhhmdelytedqrmirdaarafatemlapnaaqwdhdahlpdaivaqlgelgllg
    mivpqelggsytdyvayalameevaagdaacatmmsvhnsvgcgpilgfgtpaqkdrwla
    dmaagrvigafcltephagseannlrtraelrdgqwvlngakqfvtngqragvaivfamt
    dpeagkrgisaflvptdtpgfivgkpekkmgirasdtcpitfencaipednllgnrgegl
    kialsnleggrigiaaqalgiaraafdkarryagervqfgkpiaehqaiqqkladmavqi
    naarllvhhaaklrtaglpclseasqaklfasemaervcsdaiqihggygylvdyeverh
    yrdaritqiyegtsevqrmviarql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5fA (A:)
    hmdelytedqrmirdaarafatemlapnaaqwdhdahlpdaivaqlgelgllgmivpqel
    ggsytdyvayalameevaagdaacatmmsvhnsvgcgpilgfgtpaqkdrwladmaagrv
    igafcltephagseannlrtraelrdgqwvlngakqfvtngqragvaivfamtdpeagkr
    gisaflvptdtpgfivgkpekkmgirasdtcpitfencaipednllgnrgeglkialsnl
    eggrigiaaqalgiaraafdkarryagervqfgkpiaehqaiqqkladmavqinaarllv
    hhaaklrtaglpclseasqaklfasemaervcsdaiqihggygylvdyeverhyrdarit
    qiyegtsevqrmviarql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n5fB (B:)
    mahhhhhhmdelytedqrmirdaarafatemlapnaaqwdhdahlpdaivaqlgelgllg
    mivpqelggsytdyvayalameevaagdaacatmmsvhnsvgcgpilgfgtpaqkdrwla
    dmaagrvigafcltephagseannlrtraelrdgqwvlngakqfvtngqragvaivfamt
    dpeagkrgisaflvptdtpgfivgkpekkmgirasdtcpitfencaipednllgnrgegl
    kialsnleggrigiaaqalgiaraafdkarryagervqfgkpiaehqaiqqkladmavqi
    naarllvhhaaklrtaglpclseasqaklfasemaervcsdaiqihggygylvdyeverh
    yrdaritqiyegtsevqrmviarql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5fB (B:)
    hmdelytedqrmirdaarafatemlapnaaqwdhdahlpdaivaqlgelgllgmivpqel
    ggsytdyvayalameevaagdaacatmmsvhnsvgcgpilgfgtpaqkdrwladmaagrv
    igafcltephlrtraelrdwvlngakqfvtngqragvaivfamtdpeagkrgisaflvpt
    dtpgfivgkpekkmgirasdtcpitfencaipednllgnrgeglkialsnleggrigiaa
    qalgiaraafdkarryagervqfgkpiaehqaiqqkladmavqinaarllvhhaaklrta
    glpclseasqaklfasemaervcsdaiqihggygylvdyeverhyrdaritqiyegtsev
    qrmviarql