PDB entry 4n4n

View 4n4n on RCSB PDB site
Description: Nitrosomonas europea HAO
Class: oxidoreductase
Keywords: C-type cytochrome, OXIDOREDUCTASE
Deposited on 2013-10-08, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxylamine oxidoreductase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n4na_
  • Chain 'B':
    Compound: hydroxylamine oxidoreductase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: hydroxylamine oxidoreductase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n4nc_
  • Chain 'D':
    Compound: hydroxylamine oxidoreductase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: hydroxylamine oxidoreductase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n4ne_
  • Chain 'F':
    Compound: hydroxylamine oxidoreductase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, HEC, K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n4nA (A:)
    distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
    ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
    leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
    aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
    nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
    skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
    tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
    fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
    iqdeytkmqelsalqarvnklegkqtslldlkgtgekislgglgggmllagalaligwrk
    rkqtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n4nA (A:)
    distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
    ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
    leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
    aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
    nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
    skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
    tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
    fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
    iqdeytkmqelsalqarvnklegk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n4nC (C:)
    distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
    ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
    leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
    aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
    nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
    skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
    tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
    fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
    iqdeytkmqelsalqarvnklegkqtslldlkgtgekislgglgggmllagalaligwrk
    rkqtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n4nC (C:)
    distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
    ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
    leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
    aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
    nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
    skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
    tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
    fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
    iqdeytkmqelsalqarvnkle
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4n4nE (E:)
    distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
    ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
    leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
    aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
    nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
    skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
    tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
    fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
    iqdeytkmqelsalqarvnklegkqtslldlkgtgekislgglgggmllagalaligwrk
    rkqtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n4nE (E:)
    distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
    ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
    leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
    aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
    nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
    skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
    tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
    fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
    iqdeytkmqelsalqarvnkleg
    

  • Chain 'F':
    No sequence available.