PDB entry 4n4c

View 4n4c on RCSB PDB site
Description: Crystal structure of the C-terminal swapped dimer of a Bovine seminal ribonuclease mutant
Class: hydrolase
Keywords: C-TERMINAL DOMAIN SWAPPING, Hydrolase, RIBONUCLEASE
Deposited on 2013-10-08, released 2013-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.171
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered mutation (15-16)
      • engineered mutation (18-19)
    Domains in SCOPe 2.05: d4n4ca_
  • Chain 'B':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered mutation (15-16)
      • engineered mutation (18-19)
    Domains in SCOPe 2.05: d4n4cb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4n4cA (A:)
    kesaaakferqhmdsstsaasssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4n4cB (B:)
    kesaaakferqhmdsstsaasssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv