PDB entry 4n45

View 4n45 on RCSB PDB site
Description: Crystal structure of reduced form of thiolase from Clostridium acetobutylicum
Class: transferase
Keywords: alpha/beta/alpha/beta/alpha domain, Acetyl-coA acetyltransferase, TRANSFERASE
Deposited on 2013-10-08, released 2014-10-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA acetyltransferase
    Species: Clostridium acetobutylicum [TaxId:863638]
    Gene: CEA_G2880
    Database cross-references and differences (RAF-indexed):
    • Uniprot F0K5D8 (0-391)
      • engineered mutation (377)
    Domains in SCOPe 2.06: d4n45a1, d4n45a2
  • Chain 'B':
    Compound: Acetyl-CoA acetyltransferase
    Species: Clostridium acetobutylicum [TaxId:863638]
    Gene: CEA_G2880
    Database cross-references and differences (RAF-indexed):
    • Uniprot F0K5D8 (0-391)
      • engineered mutation (377)
    Domains in SCOPe 2.06: d4n45b1, d4n45b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n45A (A:)
    mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
    lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
    apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal
    asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
    vtagnasglndcaavlvimsaekakelgvkplakivsygsagvdpaimgygpfyatkaai
    ekagwtvdeldliesneafaaqslavakdlkfdmnkvnvnggaialghpigasgarilvt
    lvhamqkrdakkglatlsigggqgtaillekclehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n45A (A:)
    mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
    lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
    apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal
    asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
    vtagnasglndcaavlvimsaekakelgvkplakivsygsagvdpaimgygpfyatkaai
    ekagwtvdeldliesneafaaqslavakdlkfdmnkvnvnggaialghpigasgarilvt
    lvhamqkrdakkglatlsigggqgtaillekc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n45B (B:)
    mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
    lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
    apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal
    asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
    vtagnasglndcaavlvimsaekakelgvkplakivsygsagvdpaimgygpfyatkaai
    ekagwtvdeldliesneafaaqslavakdlkfdmnkvnvnggaialghpigasgarilvt
    lvhamqkrdakkglatlsigggqgtaillekclehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n45B (B:)
    mkevviasavrtaigsygkslkdvpavdlgataikeavkkagikpedvnevilgnvlqag
    lgqnparqasfkaglpveipamtinkvcgsglrtvslaaqiikagdadviiaggmenmsr
    apylannarwgyrmgnakfvdemitdglwdafndyhmgitaeniaerwnisreeqdefal
    asqkkaeeaiksgqfkdeivpvvikgrkgetvvdtdehprfgstieglaklkpafkkdgt
    vtagnasglndcaavlvimsaekakelgvkplakivsygsagvdpaimgygpfyatkaai
    ekagwtvdeldliesneafaaqslavakdlkfdmnkvnvnggaialghpigasgarilvt
    lvhamqkrdakkglatlsigggqgtaillekc