PDB entry 4n40

View 4n40 on RCSB PDB site
Description: crystal structure of human epithelial cell-transforming sequence 2 protein
Deposited on 2013-10-08, released 2014-08-27
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ECT2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECT2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4n40A (A:)
empqietrvilvqeagkqeelikalkdikvgfvkmesveefegldspefenvfvvtdfqd
svfndlykadcrvigppvvlncsqkgeplpfscrplyctsmmnlvlcftgfrkkeelvrl
vtlvhhmggvirkdfnskvthlvanctqgekfrvavslgtpimkpewiykawerrneqdf
yaavddfrnefkvppfqdcilsflgfsdeektnmeemtemqggkylplgdercthlvvee
nivkdlpfepskklyvvkqewfwgsiqmdaragetmylyek