PDB entry 4n3y

View 4n3y on RCSB PDB site
Description: Crystal structure of Rabex-5CC and Rabaptin-5C21 complex
Class: endocytosis
Keywords: Rab5, Rabex-5, Rabaptin-5, GEF activity, endocytosis, early endosome
Deposited on 2013-10-08, released 2014-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab5 GDP/GTP exchange factor
    Species: Homo sapiens [TaxId:9606]
    Gene: RABEX5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Rab GTPase-binding effector protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RABEP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4n3yb_
  • Chain 'C':
    Compound: Rab GTPase-binding effector protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RABEP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4n3yc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4n3yB (B:)
metrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseill
eelqqglsqakrdvqeqmavlmqsreqvseel

    Sequence, based on observed residues (ATOM records): (download) 
    >4n3yB (B:)
etrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseille
elqqglsqakrdvqeqmavlmqs

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4n3yC (C:)
metrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseill
eelqqglsqakrdvqeqmavlmqsreqvseel

    Sequence, based on observed residues (ATOM records): (download) 
    >4n3yC (C:)
etrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseille
elqqglsqakrdvqeqmavlmqs