PDB entry 4n27

View 4n27 on RCSB PDB site
Description: X-ray structure of Brucella abortus RicA
Class: transferase
Keywords: gamma carbonic anhydrase, Zinc binding, TRANSFERASE
Deposited on 2013-10-04, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.208
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial transferase hexapeptide repeat
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1279, BruAb1_1263
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n27a_
  • Chain 'B':
    Compound: Bacterial transferase hexapeptide repeat
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1279, BruAb1_1263
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n27b_
  • Chain 'C':
    Compound: Bacterial transferase hexapeptide repeat
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1279, BruAb1_1263
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n27c_
  • Chain 'D':
    Compound: Bacterial transferase hexapeptide repeat
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1279, BruAb1_1263
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n27d_
  • Chain 'E':
    Compound: Bacterial transferase hexapeptide repeat
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1279, BruAb1_1263
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n27e_
  • Chain 'F':
    Compound: Bacterial transferase hexapeptide repeat
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1279, BruAb1_1263
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4n27f_
  • Heterogens: ZN, PE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n27A (A:)
    mgsshhhhhhssglvprgshmpiyaynghkpqfadresnwiapdatligkvvvgenagfw
    fgavlrgdnepitigadtnvqeqtimhtdigfpltigagctighrailhgctigentlig
    mgaivlngakvgkncligagtlvkegmeipdnslvvgsparvlrqlddaaveklrasakh
    yverghsfmrgmepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n27A (A:)
    mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
    qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
    tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n27B (B:)
    mgsshhhhhhssglvprgshmpiyaynghkpqfadresnwiapdatligkvvvgenagfw
    fgavlrgdnepitigadtnvqeqtimhtdigfpltigagctighrailhgctigentlig
    mgaivlngakvgkncligagtlvkegmeipdnslvvgsparvlrqlddaaveklrasakh
    yverghsfmrgmepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n27B (B:)
    mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
    qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
    tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n27C (C:)
    mgsshhhhhhssglvprgshmpiyaynghkpqfadresnwiapdatligkvvvgenagfw
    fgavlrgdnepitigadtnvqeqtimhtdigfpltigagctighrailhgctigentlig
    mgaivlngakvgkncligagtlvkegmeipdnslvvgsparvlrqlddaaveklrasakh
    yverghsfmrgmepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n27C (C:)
    mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
    qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
    tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n27D (D:)
    mgsshhhhhhssglvprgshmpiyaynghkpqfadresnwiapdatligkvvvgenagfw
    fgavlrgdnepitigadtnvqeqtimhtdigfpltigagctighrailhgctigentlig
    mgaivlngakvgkncligagtlvkegmeipdnslvvgsparvlrqlddaaveklrasakh
    yverghsfmrgmepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n27D (D:)
    mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
    qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
    tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4n27E (E:)
    mgsshhhhhhssglvprgshmpiyaynghkpqfadresnwiapdatligkvvvgenagfw
    fgavlrgdnepitigadtnvqeqtimhtdigfpltigagctighrailhgctigentlig
    mgaivlngakvgkncligagtlvkegmeipdnslvvgsparvlrqlddaaveklrasakh
    yverghsfmrgmepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n27E (E:)
    mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
    qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
    tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4n27F (F:)
    mgsshhhhhhssglvprgshmpiyaynghkpqfadresnwiapdatligkvvvgenagfw
    fgavlrgdnepitigadtnvqeqtimhtdigfpltigagctighrailhgctigentlig
    mgaivlngakvgkncligagtlvkegmeipdnslvvgsparvlrqlddaaveklrasakh
    yverghsfmrgmepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n27F (F:)
    mpiyaynghkpqfadresnwiapdatligkvvvgenagfwfgavlrgdnepitigadtnv
    qeqtimhtdigfpltigagctighrailhgctigentligmgaivlngakvgkncligag
    tlvkegmeipdnslvvgsparvlrqlddaaveklrasakhyverghsfmrgmepa