PDB entry 4n19

View 4n19 on RCSB PDB site
Description: Structural basis of conformational transitions in the active site and 80 s loop in the FK506 binding protein FKBP12
Class: isomerase
Keywords: isomerase
Deposited on 2013-10-03, released 2014-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.13
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP1A, FKBP1, FKBP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered mutation (21)
      • engineered mutation (88)
    Domains in SCOPe 2.08: d4n19a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4n19A (A:)
    gvqvetispgdgrtfpkrgqtvvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghppiipphatlvfdvellkle