PDB entry 4n0z

View 4n0z on RCSB PDB site
Description: Crystal structure of cisplatin bound to a plasmodium falciparum glutaredoxin 1 (PfGrx1)
Class: oxidoreductase
Keywords: Glutathione, Active site, TRX FOLD, Redox Enzyme, Pt-SAD, cisplatin, OXIDOREDUCTASE
Deposited on 2013-10-03, released 2014-10-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: GRX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4n0za_
  • Heterogens: MPO, MPD, CPT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4n0zA (A:)
magtseavkkwvnkiieeniiavfaktecpycikaisilkgynlnshmhvenieknpdma
niqaylkeltgkssvprifinkdvvggcddlvkendegklkerlqklglvn

    Sequence, based on observed residues (ATOM records): (download) 
    >4n0zA (A:)
seavkkwvnkiieeniiavfaktecpycikaisilkgynlnshmhvenieknpdmaniqa
ylkeltgkssvprifinkdvvggcddlvkendegklkerlqklglvn