PDB entry 4n0k

View 4n0k on RCSB PDB site
Description: Atomic resolution crystal structure of a cytochrome c-calixarene complex
Class: electron transport
Keywords: all alpha, electron carrier protein, electron transport, mitochondrion
Deposited on 2013-10-02, released 2014-09-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.158
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CYC1, J1653, YJR048W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-105)
    • engineered mutation (17)
    • expression tag (106-107)
  Domains in SCOPe 2.06: d4n0ka1, d4n0ka2
• Chain 'B':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CYC1, J1653, YJR048W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-105)
    • engineered mutation (17)
    • expression tag (106-107)
  Domains in SCOPe 2.06: d4n0kb1, d4n0kb2
• Heterogens: HEM, T3Y, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4n0kA (A:)
  tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4n0kB (B:)
  tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate