PDB entry 4n0k

View 4n0k on RCSB PDB site
Description: Atomic resolution crystal structure of a cytochrome c-calixarene complex
Class: electron transport
Keywords: all alpha, electron carrier protein, electron transport, mitochondrion
Deposited on 2013-10-02, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYC1, J1653, YJR048W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-105)
      • engineered mutation (17)
      • expression tag (106-107)
    Domains in SCOPe 2.08: d4n0ka1, d4n0ka2
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYC1, J1653, YJR048W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-105)
      • engineered mutation (17)
      • expression tag (106-107)
    Domains in SCOPe 2.08: d4n0kb1, d4n0kb2
  • Heterogens: HEC, T3Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4n0kA (A:)
    tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4n0kB (B:)
    tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate