PDB entry 4n0i

View 4n0i on RCSB PDB site
Description: Crystal structure of S. cerevisiae mitochondrial GatFAB in complex with glutamine
Deposited on 2013-10-02, released 2014-04-16
The last revision was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GatA, GEP6, HER2, LRC6, YMR293C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GatB, PET112, YBL0724, YBL080C
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit F, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GatF, GTF1, YGR102C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GLN, NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4n0iA (A:)
    mplkrslkesierlssfqskyniftsinpspysitnkkgtketltgcvasikdnivtkdf
    pttcashilenfkspfdatvvkllkqagvhilgktnldefgmgsggvhsirgpvinplyp
    hedkkimggsssgaaasvacdlvdfalgtdtggsvrlpacygsvlgfkpsygrlsrfgvi
    aysqsldtvgilskkinvlrkvfhtldkydmkdptslsvelreliegnkkvrrplkvgiv
    kefshesmpigfhrlylslleklinlgleiypvsipsvknclpiyytlspaeaasnlsry
    dgirygyrdseldikdgilfaptrskfgtevknriilgnynlcsdafknnfikaeklrvn
    lidefdgifrfpnvltnskgnpdgldllivptssklpgsirdfeeeeakspansyindvf
    tvpmslaglpslsmplkektpiglqvvgqygddstvldfvesis
    

    Sequence, based on observed residues (ATOM records):
    >4n0iA (A:)
    slkesierlssfqskyniftsinpspystltgcvasikdnivtkdfpttcashilenfks
    pfdatvvkllkqagvhilgktnldefgmgsggvhsirgpvinplyphedkkimggsssga
    aasvacdlvdfalgtdtggsvrlpacygsvlgfkpsygrlsrfgviaysqsldtvgilsk
    kinvlrkvfhtldkydmkdptslsvelreliegnkkvrrplkvgivkefshesmpigfhr
    lylslleklinlgleiypvsipsvknclpiyytlspaeaasnlsrydgirygyrdseldi
    kdgilfaptrskfgtevknriilgnynlcsdafknnfikaeklrvnlidefdgifrfpnv
    ltnskgnpdgldllivptssklpgsirdfeeeeakspansyindvftvpmslaglpslsm
    plkektpiglqvvgqygddstvldfvesis
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4n0iB (B:)
    ihshgapfrpeyalkcgleihtqlntknklfsqstnsatslvdapnhhtsyydialpgtq
    pvlnleailfamklslalgsqvnsisqfdrkhyfygdqpqgyqltqhyrpfarggkinls
    kelddidesakeigilqlqieqdtgkshytetdkdvitlvdlnrsnvplielvtkpdfsd
    ikqvrafikkyqnlvrhlhissgdletgamrvdvnlsineyarvelknlpntssiinaik
    yeyqrqvelisvgdtsslmepetrgwtgsstvklrskettidyrympdpelpyinlapdv
    isgvrglmpqlpddlessgenlyfq
    

    Sequence, based on observed residues (ATOM records):
    >4n0iB (B:)
    yalkcgleihtqlntknklfsqstnsatslvdapnhhtsyydialpgtqpvlnleailfa
    mklslalgsqvnsisqfdrkhyfygdqpqgyqltqhyrpfarggkinlskelddidesak
    eigilqlqieqdtgkshytvitlvdlnrsnvplielvtkpdfsdikqvrafikkyqnlvr
    hlhissgdletgamrvdvnlsineyarvelknlpntssiinaikyeyqrqveltsslmep
    etrgwtgsstvklidyrympdpelpyinlapdvisgvrglmpqlp
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >4n0iF (F:)
    fvstggakigkkfenmnqirdylsrpvwsvheylgintkeekleppsaeavkkllrlsgl
    plegadikeiqmrlakqlsfinklhnipvegekhtkeydarlvqrntkqlnytkllegis
    hqkqdaelgevsgswkatglaaesknayfvvkegllknrk
    

    Sequence, based on observed residues (ATOM records):
    >4n0iF (F:)
    gakigkkfenmnqirdylsrpvwsvheylgippsaeavkkllrlsglplegadikeiqmr
    lakqlsfinklhnipvegtkqlnytkllegishqkqdaelgevsgswkatglaaesknay
    fvvke