PDB entry 4n0a

View 4n0a on RCSB PDB site
Description: Crystal structure of Lsm2-3-Pat1C complex from Saccharomyces cerevisiae
Class: RNA binding protein
Keywords: Decapping activator, RNA BINDING PROTEIN
Deposited on 2013-10-01, released 2013-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.274
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n0aa_
  • Chain 'B':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n0ab_
  • Chain 'C':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n0ac_
  • Chain 'D':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n0ad_
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n0ae_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n0af_
  • Chain 'G':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4n0ag_
  • Chain 'H':
    Compound: DNA topoisomerase 2-associated protein pat1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MRT1, PAT1, YCR077C, YCR77C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25644
      • engineered mutation (271)
  • Chain 'I':
    Compound: DNA topoisomerase 2-associated protein pat1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MRT1, PAT1, YCR077C, YCR77C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25644
      • engineered mutation (271)
  • Chain 'J':
    Compound: DNA topoisomerase 2-associated protein pat1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MRT1, PAT1, YCR077C, YCR77C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25644
      • engineered mutation (271)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n0aA (A:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n0aA (A:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n0aB (B:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n0aB (B:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n0aC (C:)
    mgsshhhhhhsqdpmlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisct
    dekkyphlgsvrnifirgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n0aC (C:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisctdesvrnifirgstv
    ryvylnknmvdtnllqdatrrevmte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n0aD (D:)
    mgsshhhhhhsqdpmlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisct
    dekkyphlgsvrnifirgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n0aD (D:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisctdeknifirgstvry
    vylnknmvdtnllqdatrrevmte
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4n0aE (E:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n0aE (E:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdaveterrcemvfirgdt
    vtlistps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4n0aF (F:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelsese
    rrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n0aF (F:)
    metpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnseserrce
    mvfirgdtvtlistp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4n0aG (G:)
    mgsshhhhhhsqdpmlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisct
    dekkyphlgsvrnifirgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n0aG (G:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisctdesvrnifirgstv
    ryvylnknmvdtnllqdatrrevmte
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.