PDB entry 4n06

View 4n06 on RCSB PDB site
Description: Crystal structure of Cas1 from Archaeoglobus fulgidus and its nucleolytic activity
Deposited on 2013-10-01, released 2014-01-15
The last revision was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRISPR-associated endonuclease Cas1 1
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28401 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: CRISPR-associated endonuclease Cas1 1
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28401 (2-346)
      • expression tag (0-1)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4n06A (A:)
    ggmrlvvdgfgkylgienglivvkekgkalrkvrpedlkqvliigkaaissdaiklllkn
    rvdvvfldfngeilgrlshpligtaktrreqylaygdkrgvhlakefikakmanqmailt
    nlakarkdsnpevaesllkakkeidaclneldgveaemidkvrerllgiegkaskhywda
    islvipeeyrfngrrgieigspryakdivnamlnygysillaecvkavelagldpyagfl
    hvdvsgrsslaidlmenfrqqvvdrvvlrlisyrqikpedcekrnmvcqlsdnarrllla
    sllerldsktqyrgrnlayssiillhardvvaflrgerryegfvqkw
    

    Sequence, based on observed residues (ATOM records):
    >4n06A (A:)
    ggmrlvvdgfgkylgienglivvkekgkalrkvrpedlkqvliigkaaissdaiklllkn
    rvdvvfldfngeilgrlshpligtaktrreqylaygdkrgvhlakefikakmanqmailt
    nlakarkdsnpevaesllkakkeidaclneldgveaemidkvrerllgiegkaskhywda
    islvipeeyrfngrrgieigspryakdivnamlnygysillaecvkavelagldpyagfl
    hvdvsgrsslaidlmenfrqqvvdrvvlrlisyrqikpedcekrnmvcqlsdnarrllla
    sllerldsktqyrgrnlayssiillhardvvaflrgerryegfvqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4n06B (B:)
    ggmrlvvdgfgkylgienglivvkekgkalrkvrpedlkqvliigkaaissdaiklllkn
    rvdvvfldfngeilgrlshpligtaktrreqylaygdkrgvhlakefikakmanqmailt
    nlakarkdsnpevaesllkakkeidaclneldgveaemidkvrerllgiegkaskhywda
    islvipeeyrfngrrgieigspryakdivnamlnygysillaecvkavelagldpyagfl
    hvdvsgrsslaidlmenfrqqvvdrvvlrlisyrqikpedcekrnmvcqlsdnarrllla
    sllerldsktqyrgrnlayssiillhardvvaflrgerryegfvqkw