PDB entry 4mzx

View 4mzx on RCSB PDB site
Description: Crystal Structure of Benzoylformate Decarboxylase Mutant T377L/A460Y
Class: lyase
Keywords: ThDP, LYASE
Deposited on 2013-09-30, released 2015-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxlyase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906
      • engineered mutation (376)
      • engineered mutation (459)
    Domains in SCOPe 2.05: d4mzxa1, d4mzxa2, d4mzxa3
  • Heterogens: CA, GOL, TZD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mzxA (A:)
    masvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqa
    srkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlpr
    plvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
    ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
    pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtc
    dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
    tlndmapenaiylneslsttaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeper
    qviavigdgsanysisalwtaaqyniptifvimnngtygylrwfagvleaenvpgldvpg
    idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzxA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneslsttaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygylrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvsp