PDB entry 4mzt

View 4mzt on RCSB PDB site
Description: MazF from S. aureus crystal form II, C2221, 2.3 A
Class: hydrolase
Keywords: CcdB/MazF fold, ribonuclease, MazE, HYDROLASE
Deposited on 2013-09-30, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (12-13)
    Domains in SCOPe 2.07: d4mzta1, d4mzta2
  • Chain 'B':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mztb1, d4mztb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mztA (A:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mztA (A:)
    dpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthv
    eiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mztB (B:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mztB (B:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln