PDB entry 4mzp

View 4mzp on RCSB PDB site
Description: MazF from S. aureus crystal form III, C2221, 2.7 A
Class: hydrolase
Keywords: CcdB/MazF fold, ribonuclease, MazE, mRNA interferase, HYDROLASE
Deposited on 2013-09-30, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mzpa1, d4mzpa2
  • Chain 'B':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (11-13)
    Domains in SCOPe 2.07: d4mzpb1, d4mzpb2
  • Chain 'C':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mzpc1, d4mzpc2
  • Chain 'D':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mzpd1, d4mzpd2
  • Chain 'E':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mzpe1, d4mzpe2
  • Chain 'F':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mzpf1, d4mzpf2
  • Chain 'G':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mzpg1, d4mzpg2
  • Chain 'H':
    Compound: MazF mRNA interferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (13)
    Domains in SCOPe 2.07: d4mzph1, d4mzph2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mzpA (A:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpA (A:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mzpB (B:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpB (B:)
    qdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipth
    veiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mzpC (C:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpC (C:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mzpD (D:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpD (D:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4mzpE (E:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpE (E:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4mzpF (F:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpF (F:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglna
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4mzpG (G:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpG (G:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4mzpH (H:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzpH (H:)
    pirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthve
    iekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglna