PDB entry 4myq

View 4myq on RCSB PDB site
Description: Selective Inhibition of the Catalytic Domain Of Human Phosphodiesterase 4B With A-33
Class: hydrolase/hydrolase inhibitor
Keywords: PHOSPHODIESTERASE, CATALYTIC, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-09-27, released 2014-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4myqa_
  • Heterogens: 19T, MG, ZN, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4myqA (A:)
    gshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllk
    tfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaa
    ifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt
    kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnm
    vhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfi
    dyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfq
    feltldeedseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4myqA (A:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqcqglmekfqf