PDB entry 4my5

View 4my5 on RCSB PDB site
Description: Crystal structure of the aromatic amino acid aminotransferase from Streptococcus mutants
Class: transferase
Keywords: SmAroAT, Type 1 PLP-dependent aminotransferases, amino acid metabolism, oral infectious diseases, TRANSFERASE
Deposited on 2013-09-27, released 2014-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative amino acid aminotransferase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU_24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4my5a_
  • Chain 'B':
    Compound: Putative amino acid aminotransferase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU_24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4my5b_
  • Chain 'C':
    Compound: Putative amino acid aminotransferase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU_24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4my5c_
  • Chain 'D':
    Compound: Putative amino acid aminotransferase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU_24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4my5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4my5A (A:)
    gpmdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraida
    deshytgmagllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkv
    llpapaypgyepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnp
    tgvtysrqqiknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglsks
    hamtgwrlglifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyik
    rrdyiiekmeamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgk
    ygegylrisyaasmetikeamkrlkefmeqyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4my5A (A:)
    mdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraidade
    shytgmagllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkvll
    papaypgyepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnptg
    vtysrqqiknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglsksha
    mtgwrlglifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyikrr
    dyiiekmeamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgkyg
    egylrisyaasmetikeamkrlkefmeqya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4my5B (B:)
    gpmdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraida
    deshytgmagllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkv
    llpapaypgyepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnp
    tgvtysrqqiknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglsks
    hamtgwrlglifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyik
    rrdyiiekmeamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgk
    ygegylrisyaasmetikeamkrlkefmeqyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4my5B (B:)
    mdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraidada
    gllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkvllpapaypg
    yepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnptgvtysrqq
    iknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglskshamtgwrlg
    lifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyikrrdyiiekm
    eamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgkygegylris
    yaasmetikeamkrlkefmeqy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4my5C (C:)
    gpmdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraida
    deshytgmagllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkv
    llpapaypgyepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnp
    tgvtysrqqiknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglsks
    hamtgwrlglifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyik
    rrdyiiekmeamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgk
    ygegylrisyaasmetikeamkrlkefmeqyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4my5C (C:)
    mdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraidade
    shytgmagllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkvll
    papaypgyepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnptg
    vtysrqqiknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglsksha
    mtgwrlglifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyikrr
    dyiiekmeamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgkyg
    egylrisyaasmetikeamkrlkefmeq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4my5D (D:)
    gpmdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraida
    deshytgmagllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkv
    llpapaypgyepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnp
    tgvtysrqqiknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglsks
    hamtgwrlglifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyik
    rrdyiiekmeamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgk
    ygegylrisyaasmetikeamkrlkefmeqyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4my5D (D:)
    dlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraidagll
    alrqaasafvkekyhltynpdneilvtigatealsasltailepgdkvllpapaypgyep
    vvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnptgvtysrqqikn
    laevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglskshamtgwrlglif
    apavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyikrrdyiiekmeam
    kfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgkygegylrisyaa
    smetikeamkrlkefme