PDB entry 4mxk

View 4mxk on RCSB PDB site
Description: X-ray structure of Fe(II)-ZnPIXFeBMb1
Class: oxygen transport
Keywords: Globin Fold, OXYGEN TRANSPORT
Deposited on 2013-09-26, released 2014-02-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.182
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
      • engineered mutation (42)
      • engineered mutation (67)
    Domains in SCOPe 2.05: d4mxka_
  • Heterogens: ZNH, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mxkA (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
    lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg