PDB entry 4mxc

View 4mxc on RCSB PDB site
Description: Crystal structure of CMET in complex with novel inhibitor
Class: transferase/transferase inhibitor
Keywords: CMET inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-09-26, released 2014-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.18
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CMET, MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4mxca_
  • Heterogens: DWF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mxcA (A:)
    mgsshhhhhhgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrg
    hfgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgicl
    rsegsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaa
    rncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvw
    sfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemr
    psfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mxcA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
    lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
    ethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmyd
    keyysvaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
    lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig