PDB entry 4mwx

View 4mwx on RCSB PDB site
Description: Shanghai N9-zanamivir
Class: hydrolase
Keywords: 6-BLADED BETA-PROPELLER, HYDROLASE, Glycosylation
Deposited on 2013-09-25, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • PDB 4MWX (0-387)
    Domains in SCOPe 2.07: d4mwxa_
  • Heterogens: NAG, BMA, MAN, CA, ZMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mwxA (A:)
    rnfnnltkglctinswhiygkdnavrigessdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgksrmsicisgpnnn
    asavvwynrrpvaeintwarnilrtqesecvchngvcpvvftdgsatgpadtriyyfkeg
    kilkwesltgtakhieecscygertgitctckdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndpnigkcndpypgnnnngvkgfsyldgantwlgrtistasrsgyemlkvpn
    altddrskpiqgqtivlnadwsgysgsfmdywaegdcyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl