PDB entry 4mvh

View 4mvh on RCSB PDB site
Description: Crystal Structure of PDE10A with Novel Keto-Benzimidazole Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: PDE10A, Phosphodiesterase 10A, inhibitors, Keto-Benzimidazoles, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-09-24, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.163
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mvha_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mvhb_
  • Heterogens: ZN, SO4, 2F5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mvhA (A:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mvhA (A:)
    tlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrv
    pyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpl
    aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
    kqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
    mkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqw
    ekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mvhB (B:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mvhB (B:)
    ftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrr
    vpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhp
    laalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgn
    rkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegd
    emkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsq
    wekvirge