PDB entry 4muv

View 4muv on RCSB PDB site
Description: M. loti cyclic-nucleotide binding domain mutant displaying inverted ligand selectivity, cyclic-GMP bound
Class: nucleotide binding protein
Keywords: MlotiK1 CNBD mutant, cGMP-complex, CYCLIC-NUCLEOTIDE BINDING, MEMBRANE PROTEIN domain, METAL TRANSPORT, NUCLEOTIDE BINDING PROTEIN
Deposited on 2013-09-23, released 2014-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.138
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclic nucleotide-gated potassium channel mll3241
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll3241
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8 (2-141)
      • expression tag (0-1)
      • engineered mutation (70)
      • engineered mutation (74)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d4muva1, d4muva2
  • Chain 'B':
    Compound: Cyclic nucleotide-gated potassium channel mll3241
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll3241
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8 (2-End)
      • engineered mutation (70)
      • engineered mutation (74)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d4muvb_
  • Heterogens: PCG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4muvA (A:)
    gsqevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmf
    fvvegsvsvaspnpselgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcss
    speiaeifrktalerrgadasa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4muvB (B:)
    gsqevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmf
    fvvegsvsvaspnpselgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcss
    speiaeifrktalerrgadasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4muvB (B:)
    qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
    vegsvsvaspnpselgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcsssp
    eiaeifrktalerrgadas