PDB entry 4mu8

View 4mu8 on RCSB PDB site
Description: Crystal structure of an oxidized form of yeast iso-1-cytochrome c at pH 8.8
Class: electron transport
Keywords: oxidized form at pH 8.8, All alpha proteins, cytochrome C, electron carrier, Peroxidase Activity, HEME Binding, mitochondria, ELECTRON TRANSPORT
Deposited on 2013-09-20, released 2014-06-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.145
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-107)
      • engineered mutation (76)
      • engineered mutation (106)
    Domains in SCOPe 2.05: d4mu8a_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-107)
      • engineered mutation (76)
      • engineered mutation (106)
    Domains in SCOPe 2.05: d4mu8b_
  • Heterogens: HEM, SO4, TBU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mu8A (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mu8A (A:)
    efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
    vlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mu8B (B:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mu8B (B:)
    efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
    vlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase