PDB entry 4mu7

View 4mu7 on RCSB PDB site
Description: Crystal structure of cIAP1 BIR3 bound to T3450325
Class: apoptosis inhibitor
Keywords: RING-type zinc finger, Ligase, APOPTOSIS INHIBITOR
Deposited on 2013-09-20, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mu7a_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13490 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.07: d4mu7b1, d4mu7b2
  • Heterogens: ZN, 2DY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4mu7A (A:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4mu7A (A:)
nlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgry

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4mu7B (B:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4mu7B (B:)
ssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwes
gddpwvehakwfprceflirmkgqefvdeiqgr