PDB entry 4mu1

View 4mu1 on RCSB PDB site
Description: The structure of wt A. thaliana IGPD2 in complex with Mn2+, imidazole, and sulfate at 1.5 A resolution
Class: lyase
Keywords: hydro-lyase, histidine biosynthesis, manganese binding, chloroplastic, LYASE
Deposited on 2013-09-20, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mu1a1, d4mu1a2
  • Heterogens: MN, IMD, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mu1A (A:)
    aspppgdngfpaittaspiesarigevkretketnvsvkinldghgvsdsstgipfldhm
    ldqlashglfdvhvratgdthiddhhtnedvalaigtallkalgerkginrfgdftapld
    ealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagkns
    hhiieatfkafaralrqatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mu1A (A:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr