PDB entry 4mtm

View 4mtm on RCSB PDB site
Description: crystal structure of the tail fiber gp53 from acinetobacter baumannii bacteriophage ap22
Deposited on 2013-09-19, released 2014-10-01
The last revision was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative tail fiber protein
    Species: Acinetobacter bacteriophage AP22 [TaxId:1187128]
    Gene: ORF53
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, BR, NA, EDO, SO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4mtmA (A:)
rslianntvnpnnglggawevysgqgsiptatsttagitkvlnvlnsndvgsalsaaqgk
vlndkfnfqnsknqsgyvrlgdsgliiqwgvftstktqsnlifplafpnallsitgnlns
ntpdvigidfdlstatktsiktgaaqvgaswlsgkkiswiaigy

    Sequence, based on observed residues (ATOM records):
    >4mtmA (A:)
iptatsttagitkvlnvlnsndvgsalsaaqgkvlndkfnfqnsknqsgyvrlgdsglii
qwgvftstktqsnlifplafpnallsitgnlnsntpdvigidfdlstatktsiktgaaqv
gaswlsgkkiswiaigy