PDB entry 4mti

View 4mti on RCSB PDB site
Description: Crystal structure of cIAP1 BIR3 bound to T3258042
Class: apoptosis inhibitor
Keywords: RING-type zinc finger, Ligase, Apoptosis Inhibitor
Deposited on 2013-09-19, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13490 (22-114)
      • expression tag (21)
    Domains in SCOPe 2.07: d4mtia1, d4mtia2
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mtib_
  • Heterogens: ZN, 2DX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mtiA (A:)
    mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
    vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mtiA (A:)
    ssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwes
    gddpwvehakwfprceflirmkgqefvdeiqgry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mtiB (B:)
    mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
    vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mtiB (B:)
    nlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
    wvehakwfprceflirmkgqefvdeiqgry