PDB entry 4mta

View 4mta on RCSB PDB site
Description: Crystal structure of Pim-1 kinase domain in complex with 2-methyl-5-phenylfuran-3-carboxylic acid
Class: transferase
Keywords: Serine/threonine-protein kinase, ATP-binding, TRANSFERASE
Deposited on 2013-09-19, released 2015-01-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4mtaa_
  • Heterogens: 2D2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mtaA (A:)
    gkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvp
    mevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsf
    fwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvy
    sppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhli
    rwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mtaA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh