PDB entry 4mt2

View 4mt2 on RCSB PDB site
Description: comparison of the nmr solution structure and the x-ray crystal structure of rat metallothionein-2
Class: metallothionein
Keywords: metallothionein
Deposited on 1993-02-26, released 1993-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallothionein isoform II
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4mt2a_
  • Heterogens: CD, ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mt2A (A:)
    mdpncscatdgscscagsckckqckctsckksccsccpvgcakcsqgcickeasdkcscc
    a