PDB entry 4mt2

View 4mt2 on RCSB PDB site
Description: comparison of the nmr solution structure and the x-ray crystal structure of rat metallothionein-2
Deposited on 1993-02-26, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4mt2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4mt2_ (-)
    mdpncscatdgscscagsckckqckctsckksccsccpvgcakcsqgcickeasdkcscc
    a