PDB entry 4mst

View 4mst on RCSB PDB site
Description: Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis
Class: sugar binding protein
Keywords: lectin, chitinase-like protein, all alpha, extracellular, hydrolase-like protein, inactive chitinase, SUGAR BINDING PROTEIN
Deposited on 2013-09-18, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.168
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class I chitinase
    Species: Hevea brasiliensis [TaxId:3981]
    Gene: Hbchi-L1, rq30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4msta_
  • Chain 'B':
    Compound: Class I chitinase
    Species: Hevea brasiliensis [TaxId:3981]
    Gene: Hbchi-L1, rq30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4mstb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mstA (A:)
    siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq
    tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny
    nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi
    sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mstA (A:)
    siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq
    tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny
    nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi
    sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mstB (B:)
    siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq
    tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny
    nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi
    sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mstB (B:)
    siisrstfeemlkhrndaacpakgfytydafisaakafpafgttgdvdtckreiaaffgq
    tshattggwptapdgpyawgycykeelnqassycspspaypcapgkkyygrgpiqlswny
    nygqcgqalgldllnnpdlvatdrvisfkaaiwfwmtpqfpkpschdvitgqwsptghdi
    sagrapgygvitniingglecgrgwdarvedrigfykrycdmfavgygsnldcynqtpfg