PDB entry 4ms2

View 4ms2 on RCSB PDB site
Description: Structural basis of Ca2+ selectivity of a voltage-gated calcium channel
Class: metal transport
Keywords: Tetrameric, Voltage-gated Ion Channel, Voltage-gated Calcium Channel, Calcium Selective, Transport protein, Membrane, METAL TRANSPORT
Deposited on 2013-09-18, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.233
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-236)
      • conflict (194-195)
      • conflict (198)
      • conflict (234)
    Domains in SCOPe 2.07: d4ms2a_
  • Chain 'B':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-236)
      • conflict (194-195)
      • conflict (198)
      • conflict (234)
    Domains in SCOPe 2.07: d4ms2b_
  • Chain 'C':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-236)
      • conflict (194-195)
      • conflict (198)
      • conflict (234)
    Domains in SCOPe 2.07: d4ms2c_
  • Chain 'D':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-236)
      • conflict (194-195)
      • conflict (198)
      • conflict (234)
    Domains in SCOPe 2.07: d4ms2d_
  • Heterogens: PX4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ms2A (A:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaicvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ms2A (A:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaicvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ms2B (B:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaicvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ms2B (B:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaicvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ms2C (C:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaicvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ms2C (C:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaicvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ms2D (D:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtlddwsngivrplmevypyawvffipfifvvtfvminlvvaicvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ms2D (D:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlddws
    ngivrplmevypyawvffipfifvvtfvminlvvaicvd