PDB entry 4mru

View 4mru on RCSB PDB site
Description: Crystal structure of a susD homolog (BT1281) from Bacteroides thetaiotaomicron VPI-5482 at 1.90 A resolution
Class: sugar binding protein
Keywords: TPR- like protein, mucin O-glycan binding, PF12741 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SUGAR BINDING PROTEIN
Deposited on 2013-09-17, released 2013-10-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.137
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SusD homolog
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1281
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4mrua_
  • Chain 'B':
    Compound: SusD homolog
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_1281
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4mrub_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mruA (A:)
    gdtdmnrnkyevdseeigrenydlgstirglqglvipaqehlyqfmeamcggsyagyfge
    trtgwlekystynpktdwlkapftdvisetypkyyavlqhedapvalalakllrvtimqr
    vtdiygpipyskvlvsgegsesdglnaaydsqkdvymrmfqeleeadqalednmtegnsg
    feklddvyygklqqwrlflhslqlrmamrlcytdmaaeaqsiaekavtagvieknddnal
    fhvaenrsalcfndwkdyrvgadiicymngyadprrdkyftkvknndqegyygmrigins
    pfsdddmitsysnrlmtasdpyvwmtasevaflraegalrkwnmggeakdfyetgvklsf
    eehgasgaedylnsiaspsgytdplgsystgspanitvkwnemgeqafeenleriitqkw
    ialfpngieswsehrrtgypkllpvvvnkgrnvsteagmrrlmypneeytqnsfhlnnai
    nvlikessnnqggdtggthvwwdrkank
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mruA (A:)
    nydlgstirglqglvipaqehlyqfmeamcggsyagyfgetrtgwlekystynpktdwlk
    apftdvisetypkyyavlqhedapvalalakllrvtimqrvtdiygpipyskvlnaayds
    qkdvymrmfqeleeadqalednmtegnsgfeklddvyygklqqwrlflhslqlrmamrlc
    ytdmaaeaqsiaekavtagvieknddnalfhvaenrsalcfndwkdyrvgadiicymngy
    adprrdkyftkvknndqegyygmriginspfsdddmitsysnrlmtasdpyvwmtaseva
    flraegalrkwnmggeakdfyetgvklsfeehgasgaedylnsiaspsgytdplgsystg
    spanitvkwnemgeqafeenleriitqkwialfpngieswsehrrtgypkllpvvvnkgr
    nvsteagmrrlmypneeytqnsfhlnnainvlikessnnqggdtggthvwwdrkan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mruB (B:)
    gdtdmnrnkyevdseeigrenydlgstirglqglvipaqehlyqfmeamcggsyagyfge
    trtgwlekystynpktdwlkapftdvisetypkyyavlqhedapvalalakllrvtimqr
    vtdiygpipyskvlvsgegsesdglnaaydsqkdvymrmfqeleeadqalednmtegnsg
    feklddvyygklqqwrlflhslqlrmamrlcytdmaaeaqsiaekavtagvieknddnal
    fhvaenrsalcfndwkdyrvgadiicymngyadprrdkyftkvknndqegyygmrigins
    pfsdddmitsysnrlmtasdpyvwmtasevaflraegalrkwnmggeakdfyetgvklsf
    eehgasgaedylnsiaspsgytdplgsystgspanitvkwnemgeqafeenleriitqkw
    ialfpngieswsehrrtgypkllpvvvnkgrnvsteagmrrlmypneeytqnsfhlnnai
    nvlikessnnqggdtggthvwwdrkank
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mruB (B:)
    nydlgstirglqglvipaqehlyqfmeamcggsyagyfgetrtgwlekystynpktdwlk
    apftdvisetypkyyavlqhedapvalalakllrvtimqrvtdiygpipyskvnaaydsq
    kdvymrmfqeleeadqalednmtegnsgfeklddvyygklqqwrlflhslqlrmamrlcy
    tdmaaeaqsiaekavtagvieknddnalfhvaenrsalcfndwkdyrvgadiicymngya
    dprrdkyftkvknndqegyygmriginspfsdddmitsysnrlmtasdpyvwmtasevaf
    lraegalrkwnmggeakdfyetgvklsfeehgasgaedylnsiaspsgytdplgsystgs
    panitvkwnemgeqafeenleriitqkwialfpngieswsehrrtgypkllpvvvnkgrn
    vsteagmrrlmypneeytqnsfhlnnainvlikessnnqggdtggthvwwdrka