PDB entry 4mrt

View 4mrt on RCSB PDB site
Description: Structure of the Phosphopantetheine Transferase Sfp in Complex with Coenzyme A and a Peptidyl Carrier Protein
Class: transport protein/transferase
Keywords: PCP: Aminoacyl/peptidyl carrier, Sfp: Phosphopantetheine transferase, Sfp: Coenzyme A binding, TRANSPORT PROTEIN-TRANSFERASE complex
Deposited on 2013-09-17, released 2014-04-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4'-phosphopantetheinyl transferase sfp
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU03570, lpa-8, sfp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39135 (0-223)
      • variant (21)
      • variant (96)
      • cloning artifact (224)
    Domains in SCOPe 2.05: d4mrta1, d4mrta2
  • Chain 'C':
    Compound: Tyrocidine synthase 3
    Species: Brevibacillus parabrevis [TaxId:54914]
    Gene: TYCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30409 (6-81)
      • engineered mutation (43)
      • cloning artifact (82)
    Domains in SCOPe 2.05: d4mrtc_
  • Heterogens: MG, COA, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mrtA (A:)
    mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
    ldksdirfstqeygkpcipdlpdahfnishsgrwvigafdsqpigidiektkpisleiak
    rffskteysdllakdkdeqtdyfyhlwsmkesfikqegkglslpldsfsvrlhqdgqvsi
    elpdshspcyiktyevdpgykmavcaahpdfpeditmvsyeellrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mrtA (A:)
    mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
    ldksdirfstqeygkpcipdlpdahfnishsgrwvigafdsqpigidiektkpisleiak
    rffskteysdllakdkdeqtdyfyhlwsmkesfikqegkglslpldsfsvrlhqdgqvsi
    elpdshspcyiktyevdpgykmavcaahpdfpeditmvsyeellr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mrtC (C:)
    pvteaqyvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqv
    elplkvlfaqptikalaqyvatrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mrtC (C:)
    yvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqvelplkv
    lfaqptikalaqyvatr