PDB entry 4mrd

View 4mrd on RCSB PDB site
Description: Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule
Class: cell adhesion
Keywords: Link module, Cell receptor, Hyaluronan binding, Cell surface, Cell adhesion
Deposited on 2013-09-17, released 2014-04-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD44 antigen
    Species: Mus musculus [TaxId:10090]
    Gene: Cd44, Cd44 Ly-24, Ly-24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4mrda_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4mrdA (A:)
qidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcryg
fiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpnsf
dgpvtitivnrdgtryskkgeyrthqedi